PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN27781.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 598aa    MW: 67931.1 Da    PI: 5.7797
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN27781.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.71.1e-122266348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      WT++Ed++l + +  +G+++W+ Ia+++   +t  qc+ rw++yl
       KHN27781.1 22 TWTQQEDDILREEIGIHGTENWAIIASKFK-DKTTRQCRRRWYTYL 66
                     6****************************9.*************97 PP

2Myb_DNA-binding42.41.6e-1372115146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g W++eEd ll +a k +G++ W+ Ia+ +  gRt++ +k+r+ +
       KHN27781.1  72 KGGWSAEEDILLCEAQKIFGNR-WTEIAKVVS-GRTDNAVKNRFST 115
                      688*******************.*********.**********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.2581566IPR017930Myb domain
SMARTSM007172.3E-121968IPR001005SANT/Myb domain
CDDcd001671.99E-112266No hitNo description
Gene3DG3DSA:1.10.10.601.2E-182373IPR009057Homeodomain-like
PfamPF139211.2E-132383No hitNo description
SuperFamilySSF466899.36E-2545125IPR009057Homeodomain-like
PROSITE profilePS5129420.73267121IPR017930Myb domain
SMARTSM007174.6E-1471119IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.5E-1974120IPR009057Homeodomain-like
CDDcd001671.05E-975116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 598 aa     Download sequence    Send to blast
MVQDMKQQDN GESKKKERHI VTWTQQEDDI LREEIGIHGT ENWAIIASKF KDKTTRQCRR  60
RWYTYLNSDF KKGGWSAEED ILLCEAQKIF GNRWTEIAKV VSGRTDNAVK NRFSTLCRKK  120
QKYEALAKEN STSYINSNNK RVMFQHCNNM DTTSESGVPI KNLRRTHIHY NAEKIKFEDR  180
LHLRNETPIN QQPRAPLAVL AQNSHNSNNL PDQHHVCNPK FSSLAQNYKI QGTFLKKDYP  240
KISALMQQAE LLSSLALKVD AGNMDQSFEN AWKVLQEFLK RTKESNIPGQ KIPDLQLVDH  300
KDMIEELKSG NEEGQVLQEL LNRTKESDNA GHNIPDLQPV DLKDMIENLK SGNEEGLVLQ  360
EFLNQTNRAD IPEHKIPHLW LVDHKDMIEK FKSGNEEGQV LQEFLNRTKE SDIPGHKIPD  420
LQLVDLKDVI EDLKSGNEEG QACWRQVDRY EDSPGSSGYS TGSILLCESA GDNLEPSFHQ  480
DIGTELKSEQ LEDEKGVGRD DGKVVLSTLN VDQDTLPCFE EQINNDGIVS ASSRLEFSSP  540
LQVTPLFRSL AAGIPSPQFS ESERNFLRKT LGMESPSINP SANSSQPPPC KRALLPSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-262312010107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150342e-51AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006602308.10.0PREDICTED: uncharacterized protein LOC100793723
RefseqXP_006602309.10.0PREDICTED: uncharacterized protein LOC100793723
TrEMBLA0A0B2R1F20.0A0A0B2R1F2_GLYSO; Myb-related protein B
STRINGGLYMA18G16040.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34803461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02820.11e-119myb domain protein 88
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]